PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00117316001
Common NameGSBRNA2T00117316001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 373aa    MW: 41640.7 Da    PI: 6.3265
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00117316001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.99.7e-091357341
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                         +r C+ + + +++++C  ++ +lC++C +  H+       H++v 
  GSBRNA2T00117316001 13 ARACDSCVKRRARWYCAADDAFLCQSCDTLVHSAnllarrHERVL 57
                         578*****************************6688888898875 PP

2CCT68.32e-23314357144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  GSBRNA2T00117316001 314 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 357
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.4661158IPR000315B-box-type zinc finger
SMARTSM003361.9E-101158IPR000315B-box-type zinc finger
PfamPF006431.0E-71357IPR000315B-box-type zinc finger
CDDcd000211.42E-91458No hitNo description
PROSITE profilePS5101716.083314356IPR010402CCT domain
PfamPF062035.9E-18314356IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MKSLASAVGA KTARACDSCV KRRARWYCAA DDAFLCQSCD TLVHSANLLA RRHERVLLKS  60
ASKHSNHNHN HSPSSPPHEA ATWHHGFTRK PRTPRGSGKK NNLSIFHALV PEISVEDQTE  120
GCELEEQLIC QVPVLDPTVA EQILNDVVEA KIEFPIMRSG VMMDDQEDED NDESCLNGFF  180
PTGMELEEYA ADVESLLGRG LDTESYAMEE LGFDYESHNT YEEEALKNVE SSGECITVKE  240
EEQKNVLMLR LNYESVISTW GGQGPPWTSG EPPERDVDIS GWPVVSMGGN VRESQQKHHV  300
GGCLPSSGFG DGGREARVSR YREKRRTRLF SKKIRYEVRK LNAEKRPRMK GRFVKRASLA  360
VSAMNSPLGV NY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1324340RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.40540.0bud| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00117316001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894760.0AC189476.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB080N15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013711556.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
SwissprotQ8RWD00.0COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A078ERG60.0A0A078ERG6_BRANA; BnaC07g10760D protein
STRINGBra012475.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]